MGC45491 (Middle Region) antibody

Catalog No. ABIN632827

This Rabbit Polyclonal antibody specifically detects in WB. It exhibits reactivity toward Human.

Quick Overview for MGC45491 (Middle Region) antibody (ABIN632827)

Target: MGC45491

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Binding Specificity: Middle Region

Specificity: MGC45491 antibody was raised against the middle region of Mgc45491

Purification: Affinity purified

Immunogen: MGC45491 antibody was raised using the middle region of Mgc45491 corresponding to a region with amino acids CRPLRPLLGFRESDSAKPASLRLLQHTPSARRNYRIAGARLMRSNYPPPL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MGC45491 Blocking Peptide, (ABIN937182), is also available for use as a blocking control in assays to test for specificity of this MGC45491 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC45491 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: MGC45491

Background: The function of MGC45491 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 26 kDa (MW of target protein)